Recombinant Mouse 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 3 (Hsd3b3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify this in your order for prioritized development.
Synonyms
Hsd3b3; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 3; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type III; 3-beta-HSD III [Includes: 3-beta-hydroxy-Delta(5-steroid dehydrogenase; 3-beta-hydroxy-5-ene steroid dehydrogenase; Progesterone reductase; Steroid Delta-isomerase; Delta-5-3-ketosteroid isomerase]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-373
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Hsd3b3
Target Protein Sequence
PGWSCLVTGAGGFLGQRIIQLLVQEKDLEEIRVLDKVFKPETREQFFNLGTSIKVTVLEG DILDTQYLRRACQGISVVIHTAAIIDVTGVIPRQTILDVNLKGTQNLLEACIQASVPAFI FSSSVDVAGPNSYKDIVLNGHEDEHRESTWSDPYPYSKKMAEKAVLAANGSMLKNGGTLQ TCALRPMCIYGERSQFLSNTIIKALKNKFILRGGGKFSTANPVYVGNVAWAHILAARGLR NPKKSPNIQGEFYYISDDTPHQSYDDLNYTLSKEWGFCLNSRWYLPVPILYWLAFLLETV SFLLSPIYRYIPPFNRHLVTLTASTFTFSYKKAQRDLGYEPLVSWEEAKQKTSEWIGTLV EQHRETLDTKSQ
Uniprot No.

Target Background

Function

3β-HSD is a bifunctional enzyme catalyzing the oxidative conversion of Δ5-ene-3β-hydroxy steroids and the oxidative conversion of ketosteroids. The 3β-HSD enzymatic system plays a critical role in the biosynthesis of all hormonal steroid classes.

Database Links
Protein Families
3-beta-HSD family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.
Tissue Specificity
Liver and kidney. Greater expression in liver.

Q&A

What is the primary function of 3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase type 3 in mice?

3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase (3β-HSD) enzymes are essential for the biosynthesis of all biologically active steroid hormones. The type 3 isoform (Hsd3b3) is primarily expressed in the liver and kidneys. These enzymes catalyze the conversion of delta 5-3 beta-hydroxysteroids to delta 4-3-ketosteroids, which represents a critical step in steroid hormone production pathways. This conversion is necessary for the synthesis of progesterone, androgens, estrogens, glucocorticoids, and mineralocorticoids .

The tissue distribution pattern is significant—Hsd3b3 (along with Hsd3b2) is predominantly expressed in the liver and kidneys, whereas Hsd3b1 is found in the gonads and adrenal glands. This tissue-specific expression pattern suggests specialized roles for each isoform in different physiological contexts .

How does Hsd3b3 differ structurally and functionally from other 3β-HSD isoforms?

Hsd3b3 exhibits distinct structural and functional characteristics compared to other isoforms. When analyzed by Western blot, the Hsd3b3 protein shows lower electrophoretic mobility compared to Hsd3b1, indicating differences in molecular weight or post-translational modifications .

Functionally, Hsd3b3 demonstrates different substrate affinity profiles. While both Hsd3b1 and Hsd3b3 can catalyze the conversion of pregnenolone and dehydroepiandrosterone to progesterone and androstenedione respectively, Hsd3b3 has significantly higher Km values for all substrates. For pregnenolone specifically, the Km value is over 10-fold greater than that of Hsd3b1, indicating lower substrate affinity. Both enzymes can also catalyze the reduction of dihydrotestosterone to 5α-androstanediol using NADH as a cofactor, but with considerably higher Km values (5.5 μM for form I and 6.8 μM for form III) .

The maximum reaction velocity (Vmax) of Hsd3b1 is substantially higher than that of Hsd3b3 for all substrates examined, which correlates with differences in steady-state mRNA levels and protein expression .

What are the recommended storage and handling conditions for recombinant Hsd3b3?

For optimal stability and activity of recombinant Hsd3b3, proper storage and handling procedures are essential. The protein should be stored at -20°C to -80°C, with shelf life varying based on formulation: lyophilized form maintains stability for approximately 12 months, while the liquid form remains stable for about 6 months under these conditions .

When preparing working solutions, reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being standard in many laboratories). Importantly, researchers should minimize freeze-thaw cycles, as repeated freezing and thawing significantly compromises protein stability and activity. For short-term use, working aliquots may be stored at 4°C for up to one week .

Prior to reconstitution, it is advisable to briefly centrifuge the vial to ensure all material is at the bottom of the container, reducing potential product loss during handling .

What enzymatic assay methods can be used to measure Hsd3b3 activity?

To measure Hsd3b3 enzymatic activity, researchers can employ several complementary approaches:

  • Spectrophotometric NAD+/NADH conversion assay: This method monitors the conversion of NAD+ to NADH (or vice versa) during the dehydrogenation reaction. The assay can be performed by measuring absorbance changes at 340 nm, corresponding to NADH production or consumption. This approach allows real-time monitoring of enzyme kinetics .

  • Radioisotope-based substrate conversion assay: This technique involves incubating the enzyme with radiolabeled substrates (such as 3H-pregnenolone or 3H-dehydroepiandrosterone) and measuring the conversion to radiolabeled products (progesterone or androstenedione) using chromatographic separation methods followed by scintillation counting .

  • HPLC or LC-MS/MS analysis: For more precise quantification of substrate-to-product conversion, high-performance liquid chromatography (HPLC) or liquid chromatography-tandem mass spectrometry (LC-MS/MS) can be used to separate and quantify the steroids involved in the reaction. This is particularly useful when measuring multiple steroid conversions simultaneously .

When designing these assays, it's important to consider the appropriate cofactor (NAD+ for dehydrogenation reactions or NADH for reductive reactions) and optimal buffer conditions. The choice of substrate is also critical, with pregnenolone, dehydroepiandrosterone, and 5α-androstanediol being common options for Hsd3b3 activity measurements .

What expression systems are most effective for producing functional recombinant Hsd3b3?

For producing functional recombinant Hsd3b3, mammalian cell expression systems are generally preferred over bacterial systems due to the complex nature of this enzyme and its potential requirement for post-translational modifications. Commercial recombinant Hsd3b3 preparations are typically sourced from mammalian cell expression systems, which provide the appropriate cellular machinery for correct protein folding and modification .

For research purposes, several expression systems have been successfully employed:

  • Human embryonic kidney (HEK293) cells: These cells have been used effectively for the expression of 3β-HSD isoforms. The 293 human fetal kidney cell line specifically has demonstrated success in producing functional enzyme for activity studies .

  • COS cells: Monkey kidney-derived COS cells represent another mammalian system that has been used for transient expression of 3β-HSD proteins to study their enzymatic characteristics .

What are the critical considerations for maintaining Hsd3b3 stability during purification?

Maintaining Hsd3b3 stability during purification requires careful attention to several factors:

  • Buffer composition: Purification buffers should contain components that stabilize the protein structure, such as glycerol (typically 10-20%), reducing agents (DTT or β-mercaptoethanol) to maintain the redox state of cysteine residues, and protease inhibitors to prevent degradation.

  • Temperature control: All purification steps should be conducted at 4°C whenever possible to minimize protein denaturation and proteolytic degradation.

  • pH maintenance: The buffer pH should be carefully controlled to match the protein's stability profile, typically in the range of pH 7.0-8.0 for 3β-HSD enzymes.

  • Salt concentration: Optimal ionic strength should be maintained to prevent protein aggregation while ensuring sufficient solubility.

  • Avoiding detergents: Unless absolutely necessary, detergents should be minimized as they can potentially disrupt the native conformation of the enzyme, particularly affecting membrane-associated properties.

Throughout the purification process, researchers should monitor enzyme activity to ensure that the functional integrity of Hsd3b3 is preserved. Rapid processing and minimizing the number of purification steps can help reduce protein loss and maintain enzymatic activity .

How does the expression of Hsd3b3 vary across different mouse tissues?

The expression profile of Hsd3b3 demonstrates distinctive tissue specificity. Based on experimental data, Hsd3b3 (together with Hsd3b2) is primarily expressed in the liver and kidneys, while being notably absent or expressed at very low levels in gonads and adrenal glands. This contrasts with Hsd3b1, which is predominantly expressed in gonads and adrenal glands .

Interestingly, research in hamsters has revealed sexual dimorphism in hepatic expression patterns, with significantly higher expression levels observed in male livers compared to female livers. Whether this sexual dimorphism also exists in mice requires further investigation, but it suggests potential hormonal regulation of Hsd3b3 expression .

The distinct tissue distribution pattern implies specialized physiological roles for this isoform in liver and kidney metabolism, potentially involving local steroid synthesis or catabolism, separate from the classical steroidogenic pathways in gonads and adrenal glands .

What factors regulate Hsd3b3 expression at the transcriptional and post-transcriptional levels?

Regulation of Hsd3b3 expression involves complex mechanisms at multiple levels:

Transcriptional regulation:

  • Hormonal influences: Research suggests that sex hormones may play a significant role in regulating Hsd3b3 expression, as evidenced by the sexual dimorphism observed in liver expression .

  • Tissue-specific transcription factors: The restricted expression pattern indicates involvement of tissue-specific transcription factors that recognize regulatory elements in the Hsd3b3 promoter. Liver-enriched transcription factors (such as HNF family members) and kidney-specific transcription factors may contribute to this tissue-specific expression.

Post-transcriptional regulation:

  • mRNA stability: Differences in steady-state mRNA levels between Hsd3b isoforms suggest potential variation in mRNA stability, which could be mediated by RNA-binding proteins or microRNAs targeting the 3' untranslated region .

  • Protein turnover: The final protein levels are also influenced by the rate of protein degradation, which may differ between tissues and physiological states.

Understanding these regulatory mechanisms is crucial for interpreting experimental results and designing studies investigating Hsd3b3 function in different physiological and pathological contexts .

What are the key kinetic parameters of Hsd3b3 compared to other 3β-HSD isoforms?

The kinetic parameters of Hsd3b3 differ significantly from other 3β-HSD isoforms, particularly Hsd3b1. These differences provide insights into their distinct physiological roles:

ParameterSubstrateHsd3b1 (Form I)Hsd3b3 (Form III)Fold Difference
Km (μM)Pregnenolone<0.2>2.0>10-fold higher in Hsd3b3
Km (μM)Dehydroepiandrosterone<0.2Higher than Hsd3b1Several-fold higher in Hsd3b3
Km (μM)5α-androstanediol<0.2Higher than Hsd3b1Several-fold higher in Hsd3b3
Km (μM)Dihydrotestosterone (reduction)5.56.8~1.2-fold higher in Hsd3b3
VmaxAll substratesHigherLowerSignificantly higher in Hsd3b1

These kinetic parameters reveal that Hsd3b3 generally has lower substrate affinity (higher Km values) compared to Hsd3b1, with the most dramatic difference observed for pregnenolone. The maximum reaction velocity is also consistently lower for Hsd3b3 across all tested substrates .

The substantial differences in kinetic parameters, particularly for pregnenolone (a key intermediate in steroid hormone biosynthesis), suggest that these isoforms are optimized for different physiological contexts: Hsd3b1 for high-efficiency steroidogenesis in classical steroidogenic tissues, and Hsd3b3 potentially for handling higher substrate concentrations or playing alternative roles in liver and kidney .

How does substrate specificity differ between Hsd3b3 and other mouse 3β-HSD isoforms?

Substrate specificity patterns reveal important functional distinctions between Hsd3b3 and other 3β-HSD isoforms:

Unlike findings in other species (e.g., hamsters), where the type 3 isoform functions exclusively as a 3-ketosteroid reductase with no dehydrogenase activity, mouse Hsd3b3 maintains dual functionality as both a dehydrogenase and reductase. This suggests species-specific evolution of enzyme function and underscores the importance of not directly extrapolating findings across species .

What physiological roles does Hsd3b3 play in non-classical steroidogenic tissues?

The expression of Hsd3b3 in liver and kidneys, which are not classical steroidogenic organs, suggests specialized physiological roles distinct from gonads and adrenal glands:

  • Local steroid metabolism: Hsd3b3 may participate in local synthesis or metabolism of steroids within the liver and kidneys, potentially creating tissue-specific microenvironments of bioactive steroids independent of circulating levels.

  • Detoxification and clearance: In the liver, Hsd3b3 might contribute to the metabolism and clearance of steroid hormones, facilitating their elimination from the body.

  • Regulation of kidney function: In the kidneys, locally produced steroids could modulate water and electrolyte balance through non-genomic or genomic mechanisms.

  • Compensatory roles in deficiency states: Under conditions of classical 3β-HSD deficiency (affecting Hsd3b1), the hepatic and renal Hsd3b3 might provide compensatory steroidogenic activity, as suggested by clinical observations in humans with similar enzyme deficiencies .

  • Sexual dimorphism: The reported sexual dimorphism in expression (in hamsters) suggests potential sex-specific functions in maintaining appropriate hormonal balance or responding to sex-specific metabolic demands .

The precise physiological significance of these non-classical expression sites remains an active area of investigation and represents an important direction for future research .

What are the implications of Hsd3b3 activity for researchers studying steroid-related disorders?

Understanding Hsd3b3 activity has significant implications for researchers investigating steroid-related disorders:

  • Congenital adrenal hyperplasia (CAH): While human 3β-HSD deficiency typically involves mutations in the HSD3B2 gene, mouse models using Hsd3b3 can provide valuable insights into the pathophysiology of this rare disorder, which affects steroid hormone production, salt balance, and sexual development .

  • Steroid hormone-dependent cancers: The presence of 3β-HSD activity in non-classical steroidogenic tissues may influence local steroid levels in tumors arising from these tissues, potentially affecting cancer progression and treatment responses.

  • Metabolic disorders: Given the liver's central role in metabolism, alterations in hepatic Hsd3b3 activity might contribute to metabolic dysregulation, particularly in conditions with hormonal imbalances like obesity or diabetes.

  • Reproductive disorders: The interplay between different 3β-HSD isoforms may be relevant for understanding reproductive disorders involving steroid hormone imbalances.

  • Pharmacological interventions: Knowledge of Hsd3b3 kinetics and substrate specificity is essential for developing targeted inhibitors or modulators that could have therapeutic applications in steroid-dependent pathologies.

Researchers using mouse models should be aware of the species-specific differences in 3β-HSD isoform distribution and function when translating findings to human conditions. The presence of multiple isoforms with tissue-specific expression patterns adds complexity to the interpretation of experimental results and necessitates careful isoform-specific analysis .

How can recombinant Hsd3b3 be used in drug discovery for steroid-related diseases?

Recombinant Hsd3b3 offers valuable applications in drug discovery programs targeting steroid-related diseases:

  • High-throughput screening (HTS): Purified recombinant Hsd3b3 can be incorporated into biochemical assays for screening compound libraries to identify potential inhibitors or modulators. These assays typically monitor NAD+/NADH conversion or directly measure steroid substrate conversion using chromatographic methods.

  • Structure-activity relationship (SAR) studies: Compounds identified through initial screens can be iteratively modified and tested against recombinant Hsd3b3 to establish structure-activity relationships and optimize potency, selectivity, and pharmacokinetic properties.

  • Isoform selectivity assessment: Given the existence of multiple 3β-HSD isoforms, recombinant Hsd3b3 allows researchers to evaluate the selectivity of compounds between different isoforms, which is crucial for developing therapeutics with reduced off-target effects.

  • Mechanism-based drug design: Detailed enzymatic characterization of recombinant Hsd3b3 provides insights into its catalytic mechanism, substrate binding sites, and cofactor interactions. This information can guide rational drug design approaches, including structure-based virtual screening and fragment-based drug discovery.

  • Evaluation of steroid metabolism: Recombinant Hsd3b3 can be used to study how potential therapeutic compounds are metabolized by this enzyme, an important consideration in drug development to anticipate potential drug-drug interactions or metabolic inactivation .

What are the current methodological challenges in studying Hsd3b3 function in vivo?

Investigating Hsd3b3 function in vivo presents several methodological challenges:

  • Isoform redundancy: The presence of multiple 3β-HSD isoforms with overlapping functions complicates the interpretation of knockout or inhibition studies. Selective targeting of Hsd3b3 without affecting other isoforms requires sophisticated approaches such as isoform-specific CRISPR/Cas9 genome editing or highly selective inhibitors.

  • Tissue-specific expression: The restricted expression pattern of Hsd3b3 in liver and kidneys necessitates tissue-specific gene modulation approaches to avoid confounding systemic effects. Techniques such as conditional knockout systems (Cre-loxP) or tissue-specific promoters for transgene expression can address this challenge.

  • Quantification of enzymatic activity: Measuring Hsd3b3 activity in complex tissue environments requires sensitive and specific analytical methods. Advanced mass spectrometry techniques like LC-MS/MS with isotope dilution are increasingly employed to accurately quantify steroid metabolites in tissue samples.

  • Distinguishing from other steroidogenic enzymes: The steroidogenic pathway involves multiple enzymes with interconnected functions. Discriminating the specific contribution of Hsd3b3 requires careful experimental design, potentially including the use of specific inhibitors or genetic manipulation in combination with comprehensive steroid profiling.

  • Species differences: Significant species differences in 3β-HSD isoform distribution, regulation, and function limit direct extrapolation between animal models and humans. Researchers must carefully consider these differences when translating findings from mouse models to human applications .

What controls should be included when working with recombinant Hsd3b3 in enzymatic assays?

When designing enzymatic assays using recombinant Hsd3b3, researchers should include the following controls to ensure reliable and interpretable results:

  • Negative enzyme control: Assays performed without the addition of Hsd3b3 or with heat-inactivated enzyme to establish baseline readings and account for non-enzymatic conversions or background signal.

  • Positive enzyme control: If available, a well-characterized 3β-HSD (such as Hsd3b1) with known activity should be tested in parallel to validate assay conditions and provide a reference for activity comparisons.

  • Cofactor controls: Reactions without NAD+ (for dehydrogenase activity) or NADH (for reductase activity) to confirm cofactor dependency of the observed enzymatic activity.

  • Substrate specificity controls: Testing multiple steroid substrates (pregnenolone, dehydroepiandrosterone, 5α-androstanediol) to confirm the expected substrate specificity profile of Hsd3b3.

  • Inhibitor controls: Known inhibitors of 3β-HSD activity (such as trilostane) can be included to confirm that the observed activity is indeed attributable to 3β-HSD.

  • Time-course analysis: Measuring activity at multiple time points to ensure linearity of the enzymatic reaction during the assay period, which is essential for accurate determination of kinetic parameters.

  • Enzyme concentration range: Testing multiple enzyme concentrations to establish a dose-dependent relationship between enzyme amount and activity, confirming that the assay is measuring specific enzyme activity .

How can researchers overcome stability and activity challenges with recombinant Hsd3b3?

Working with recombinant Hsd3b3 presents several stability and activity challenges that researchers can address through these approaches:

  • Optimized buffer formulation: Including stabilizing agents such as glycerol (typically 10-50%), mild reducing agents (e.g., 1-5 mM DTT or β-mercaptoethanol), and protease inhibitors can significantly enhance enzyme stability. The specific buffer composition should be optimized empirically for Hsd3b3 .

  • Storage optimization: Dividing the protein into small single-use aliquots immediately after purification minimizes freeze-thaw cycles. Storage at -80°C provides better long-term stability than -20°C for many recombinant proteins .

  • Carrier proteins: Addition of inert carrier proteins (such as BSA at 0.1-1 mg/mL) can improve stability by preventing adsorption to container surfaces and providing collisional stabilization.

  • Cofactor management: Pre-incubating the enzyme with a low concentration of NAD+ or NADH before storage or during assays can enhance stability by promoting favorable conformations.

  • Expression tag considerations: Strategic placement of purification tags (N-terminal vs. C-terminal) and the inclusion of cleavable tags allows for tag removal after purification if the tag interferes with activity.

  • Expression system selection: Using mammalian expression systems rather than bacterial systems provides appropriate post-translational modifications and folding machinery, likely resulting in more active enzyme .

  • Activity monitoring during purification: Tracking specific activity throughout the purification process helps identify steps that compromise enzyme function, allowing protocol optimization.

  • Alternative formulations: Lyophilization in the presence of appropriate cryoprotectants can provide enhanced shelf-life compared to liquid formulations for long-term storage .

What are the most recent advances in understanding the molecular regulation of Hsd3b3 expression?

Recent advances in understanding Hsd3b3 molecular regulation have expanded our knowledge of this enzyme's role in steroid metabolism and its potential therapeutic applications:

  • Transcriptional control mechanisms: Advanced genomic approaches, including ChIP-seq and ATAC-seq, have begun to reveal the complex transcriptional regulatory networks controlling Hsd3b3 expression in liver and kidney tissues. These studies are identifying key transcription factors and enhancer elements that direct tissue-specific expression patterns.

  • Sexual dimorphism: Recent investigations have provided molecular insights into the sexual dimorphism of 3β-HSD expression in the liver, identifying sex-specific transcription factors and hormonal influences that regulate differential expression between males and females. This dimorphism suggests sex-specific roles in steroid metabolism that may have clinical implications .

  • Epigenetic regulation: Emerging evidence points to epigenetic mechanisms, including DNA methylation and histone modifications, as important regulators of Hsd3b3 expression. These epigenetic patterns may be influenced by developmental programming, aging, and environmental factors.

  • Post-transcriptional control: Advanced RNA sequencing approaches have identified potential regulatory microRNAs and RNA-binding proteins that modulate Hsd3b3 mRNA stability and translation efficiency, adding another layer of regulation beyond transcriptional control.

  • Protein-protein interactions: Recent proteomic studies have identified novel interaction partners of Hsd3b3 that may regulate its localization, activity, or stability through direct physical interactions, providing potential new targets for therapeutic intervention.

These advances are illuminating the complex regulatory networks governing Hsd3b3 expression and activity, offering new opportunities for targeted interventions in steroid-related disorders .

What emerging technologies are being applied to study Hsd3b3 function and regulation?

Several cutting-edge technologies are transforming research on Hsd3b3 function and regulation:

  • CRISPR/Cas9 genome editing: This technology allows precise modification of the Hsd3b3 gene, enabling the creation of knockout models, introduction of specific mutations, or tagging of the endogenous protein for localization studies. Innovations like base editing and prime editing permit even more precise genetic modifications without double-strand breaks.

  • Single-cell transcriptomics: This approach reveals cell-type-specific expression patterns of Hsd3b3 within heterogeneous tissues like liver and kidney, identifying specific cell populations responsible for enzyme expression and potential regulatory differences between cell types.

  • Spatial transcriptomics and proteomics: These technologies map the spatial distribution of Hsd3b3 expression within tissue architectures, providing insights into its localization relative to other enzymes in steroidogenic pathways and potential functional microdomains.

  • Cryo-electron microscopy: Recent advances in cryo-EM are enabling high-resolution structural determination of membrane-associated enzymes like 3β-HSD, potentially revealing substrate binding pockets, cofactor interactions, and conformational changes during catalysis.

  • Metabolomics: Untargeted and targeted metabolomic approaches using high-resolution mass spectrometry can comprehensively profile steroid metabolites in biological samples, revealing the impact of Hsd3b3 activity on the steroidome in different physiological and pathological states.

  • Organoids and microphysiological systems: Liver and kidney organoids derived from stem cells provide physiologically relevant 3D models for studying Hsd3b3 function in near-native cellular environments, overcoming limitations of traditional 2D cell culture systems.

  • Protein engineering and directed evolution: These approaches are being applied to create modified versions of Hsd3b3 with enhanced stability, altered substrate specificity, or novel catalytic properties for biotechnological applications.

These emerging technologies are accelerating research on Hsd3b3 and providing unprecedented insights into its biochemical properties, physiological functions, and potential roles in disease states .

How do mouse Hsd3b isoforms compare to their human orthologs in structure and function?

A comparative analysis of mouse and human 3β-HSD isoforms reveals important similarities and differences:

Understanding these species differences is crucial for researchers using mouse models to investigate human steroid-related disorders and for translating findings between species .

What evolutionary insights can be gained from studying Hsd3b3 across different species?

Evolutionary analysis of 3β-HSD enzymes across species provides valuable insights into steroid hormone metabolism and its adaptation to different physiological needs:

  • Functional diversification: The presence of multiple 3β-HSD isoforms in mice and other rodents, compared to fewer isoforms in humans, suggests evolutionary pressure for functional specialization in rodents. This diversification may reflect adaptations to different reproductive strategies or metabolic requirements.

  • Tissue-specific adaptation: The differential tissue distribution of 3β-HSD isoforms across species indicates evolutionary adaptation to species-specific physiological demands. For example, the liver-specific expression of certain isoforms in rodents may relate to their distinctive metabolic profiles.

  • Sexual dimorphism: The reported sexual dimorphism in hepatic expression of 3β-HSD in hamsters, if conserved in mice, would represent an evolutionary adaptation to sex-specific metabolic or reproductive requirements. This dimorphism may be less pronounced in species with different reproductive strategies .

  • Substrate preference evolution: Variations in substrate specificity and kinetic parameters between species and isoforms suggest evolutionary fine-tuning of enzymatic properties to match physiological needs. These adaptations may reflect different environmental pressures or reproductive strategies.

  • Evolutionary conservation of core function: Despite variations, the fundamental catalytic mechanism of 3β-HSD is conserved across species, underscoring the essential nature of this enzymatic activity in steroid hormone biology throughout vertebrate evolution.

Comparative studies of 3β-HSD across species continue to provide insights into the evolution of steroidogenic pathways and their adaptation to diverse physiological demands, offering a broader perspective on steroid biology beyond single-species studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.